PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_F8054064A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 183aa    MW: 21200.3 Da    PI: 9.6978
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_F8054064A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR138.73.3e-1211603990
                   FAR1 39 gkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                           g r+e+k++ ek + +r+etr+gC+a++k++++ +g ++v+++++ HnH+la
  Traes_1AL_F8054064A.1 11 GVRAEDKRE-EKFSYSRPETRCGCDARMKISLN-NGIYYVYEFKEAHNHSLA 60
                           556666666.88899******************.****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-81560IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MGLRKLLELI GVRAEDKREE KFSYSRPETR CGCDARMKIS LNNGIYYVYE FKEAHNHSLA  60
TGNMSQYLRS HRKVTEAQLA NAEAAKSVGI SNKATIDLMT KEACGPENLG FISTDMKNRL  120
YSKRTLKAKV GDTGGVLEYM EKKVSEDVKF FYRNYLANDT RWPIWRRHYI QWLCYSLSSA  180
WMV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703063e-45HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462721.12e-59hypothetical protein SORBIDRAFT_02g030865, partial
RefseqXP_012702351.12e-59PREDICTED: protein FAR1-RELATED SEQUENCE 12-like
TrEMBLW4ZUA41e-136W4ZUA4_WHEAT; Uncharacterized protein
STRINGLOC_Os01g06852.17e-58(Oryza sativa Japonica Group)
STRINGSb02g030865.15e-59(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-12FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]